http://scholars.ntou.edu.tw/handle/123456789/23935| DC Field | Value | Language |
|---|---|---|
| dc.contributor.author | Chang, Chin-I | en_US |
| dc.contributor.author | Chen, Li-Hao | en_US |
| dc.contributor.author | Hu, Yeh-Fang | en_US |
| dc.contributor.author | Wu, Chia-Che | en_US |
| dc.contributor.author | Tsai, Jyh-Ming | en_US |
| dc.date.accessioned | 2023-07-20T02:12:01Z | - |
| dc.date.available | 2023-07-20T02:12:01Z | - |
| dc.date.issued | 2017-05 | - |
| dc.identifier.issn | 10504648 | - |
| dc.identifier.uri | http://scholars.ntou.edu.tw/handle/123456789/23935 | - |
| dc.description.abstract | Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia beta-defensin. The computer-predicted Nile tilapia beta-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia beta defensin was recognized using Western blot analysis. It was then excised and extracted from the gel. The precise molecular mass of this spot was determined by LC-MS/MS spectrometry. Four major peptides were discovered, with molecular weights of 4293.2 Da, 4306.5 Da, 4678.9 Da, and 4715.0 Da. The calculated mass of the 40-amino-acid sequence ((27)FPWSCLSLSGVCRINCLPTELFFGPLGCGKGSLCCVSHFL(66)) of Nile tilapia beta-defensin starting from Phe27 and ending with Leu66 was 4293.18 Da, which completely matched the 4293.2 Da peptide that was obtained from the mass spectrometry analysis. This result confirmed that the cleavage site for the mature C-terminal Nile tilapia beta-defensin is at residue Ser26-Phe27, not at Ala24-25 as predicted by computer analysis. This study provides a simple but reliable model to determine the cleavage site for a mature antimicrobial peptide. (C) 2017 Elsevier Ltd. All rights reserved. | en_US |
| dc.language.iso | en_US | en_US |
| dc.publisher | ACADEMIC PRESS | en_US |
| dc.relation.ispartof | Fish & Shellfish Immunology | en_US |
| dc.subject | beta-defensin | en_US |
| dc.subject | Cleavage site | en_US |
| dc.subject | Oreochromis niloticus | en_US |
| dc.subject | Antimicrobial peptide | en_US |
| dc.subject | EXPRESSION | en_US |
| dc.title | Determining the cleavage site for the mature antimicrobial peptide of Nile tilapia β-defensin using 2D electrophoresis, western blot, and mass spectrometry analysis | en_US |
| dc.type | journal article | en_US |
| dc.identifier.doi | 10.1016/j.fsi.2017.01.010 | - |
| dc.identifier.isi | WOS:000395955800005 | - |
| dc.relation.journalvolume | 62 | en_US |
| dc.relation.pages | 41-46 | en_US |
| item.fulltext | no fulltext | - |
| item.languageiso639-1 | en_US | - |
| item.openairecristype | http://purl.org/coar/resource_type/c_6501 | - |
| item.grantfulltext | none | - |
| item.openairetype | journal article | - |
| item.cerifentitytype | Publications | - |
| crisitem.author.dept | National Taiwan Ocean University,NTOU | - |
| crisitem.author.dept | College of Life Sciences | - |
| crisitem.author.dept | Department of Aquaculture | - |
| crisitem.author.parentorg | National Taiwan Ocean University,NTOU | - |
| crisitem.author.parentorg | College of Life Sciences | - |
| Appears in Collections: | 水產養殖學系 | |
Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.